PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010917079.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family NAC
Protein Properties Length: 332aa    MW: 37874.5 Da    PI: 6.7881
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010917079.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM172.99.4e-54171431129
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 
                     lppGfrFhPtdeel+++yL +kv + ++++ ++i evd+yk+ePwdLp k++++ek+ yfF+ rd+ky+tg ++nrat++gyWkatgkdke+++ 
  XP_010917079.1  17 LPPGFRFHPTDEELITYYLYQKVMDASFNA-RAIGEVDLYKSEPWDLPFKARTGEKSGYFFCLRDRKYPTGLKTNRATEAGYWKATGKDKEIHQ- 109
                     79***************************9.89***************9999999999***********************************9. PP

             NAM  96 kgelvglkktLvfykgrapkgektdWvmheyrle 129
                     ++ l+g++ktLvfy+grapkge+t+W+mheyrle
  XP_010917079.1 110 RKFLIGMRKTLVFYRGRAPKGERTNWIMHEYRLE 143
                     999*****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019419.55E-6013168IPR003441NAC domain
PROSITE profilePS5100557.04617167IPR003441NAC domain
PfamPF023652.3E-2818142IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 332 aa     Download sequence    Send to blast
MEHGALVLSE GDDDMELPPG FRFHPTDEEL ITYYLYQKVM DASFNARAIG EVDLYKSEPW  60
DLPFKARTGE KSGYFFCLRD RKYPTGLKTN RATEAGYWKA TGKDKEIHQR KFLIGMRKTL  120
VFYRGRAPKG ERTNWIMHEY RLEREDSVYN LSRTTMNEWV ICKVFHKNSG EKKDTELVGM  180
GSRFEDGLYS TLLGPWMNDS NRSKNKASSA SVSTHVTCFS DAFEGDMSHV ELLQNCYNFA  240
CLSTSNSSKP SLQHFEVSLP GSLNTTHGAS QNLGASLVQL LENNGHRREK SFEMERENSI  300
AGLTNNYMDV HLFACQEYPN ASARPLHLDG CF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B1e-531517315171NAC domain-containing protein 19
4dul_A1e-531517315171NAC domain-containing protein 19
1ut7_B1e-531517315171NO APICAL MERISTEM PROTEIN
1ut7_A1e-531517315171NO APICAL MERISTEM PROTEIN
1ut4_B1e-531517315171NO APICAL MERISTEM PROTEIN
1ut4_A1e-531517315171NO APICAL MERISTEM PROTEIN
3swp_D2e-531517318174NAC domain-containing protein 19
3swp_C2e-531517318174NAC domain-containing protein 19
3swp_B2e-531517318174NAC domain-containing protein 19
3swp_A2e-531517318174NAC domain-containing protein 19
3swm_D2e-531517318174NAC domain-containing protein 19
3swm_C2e-531517318174NAC domain-containing protein 19
3swm_B2e-531517318174NAC domain-containing protein 19
3swm_A2e-531517318174NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010917079.10.0PREDICTED: NAC domain-containing protein 100-like
RefseqXP_010917080.10.0PREDICTED: NAC domain-containing protein 100-like
RefseqXP_010917082.10.0PREDICTED: NAC domain-containing protein 100-like
RefseqXP_010917083.10.0PREDICTED: NAC domain-containing protein 100-like
TrEMBLA0A0M3R8521e-102A0A0M3R852_MANES; NAC transcription factors 17
STRINGVIT_17s0000g06400.t015e-99(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP27303787
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G07680.13e-98NAC domain containing protein 80